<html><body><div style="color:#000; background-color:#fff; font-family:times new roman, new york, times, serif;font-size:12pt"><div style="font-family: 'times new roman', 'new york', times, serif; font-size: 12pt;">Dear group:</div><div style="font-family: 'times new roman', 'new york', times, serif; font-size: 12pt;"><br></div><div style="font-family: 'times new roman', 'new york', times, serif; font-size: 16px; color: rgb(0, 0, 0); background-color: transparent; font-style: normal;">I have 50 thousand lists. My aim is to search a pattern in the alphabetical strings (these are protein sequence strings).</div><div style="font-family: 'times new roman', 'new york', times, serif; font-size: 16px; color: rgb(0, 0, 0); background-color: transparent; font-style: normal;"><br></div><div style="font-family: 'times new roman', 'new york', times, serif; font-size: 16px; color: rgb(0, 0, 0); background-color: transparent; font-style: normal;"><br></div><div
style="background-color: transparent;"><div style="background-color: transparent;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;">MMSASRLAGTLIPAMAFLSCVRPESWEPC VEVVP NITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIED</span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;"><br></span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;">my aim is to find the list of string that has V*VVP. </span></div><div style="background-color: transparent; color: rgb(0,
0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;"><br></span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;"><span style="font-size: 16px;">myseq = 'MMSASRLAGTLIPAMAFLSCVRPESWEPC VEVVP NITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLGSYSFFSFPELQVLDLSRCEIQTIED'</span></span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;"><span style="font-size: 16px;"><br></span></span></div><div
style="background-color: transparent;"><font face="times new roman, new york, times, serif"><span class="Apple-tab-span" style="white-space:pre"> </span>if re.search('V*VVP',myseq):</font></div><div style="background-color: transparent;"><span style="background-color: transparent;"><font face="times new roman, new york, times, serif"><span class="Apple-tab-span" style="background-color: transparent; white-space: pre;"> </span><span style="background-color: transparent;">print myseq</span><span class="Apple-tab-span" style="background-color: transparent; white-space: pre;"> </span> </font></span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;"><br></span></div><div style="background-color: transparent; color: rgb(0, 0, 0);
font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;">the problem with this is, I am also finding junk with just VVP or VP etc. </span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;"><br></span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;">How can I strictly search for V*VVP only. </span></div><div style="background-color: transparent; color: rgb(0, 0, 0);
font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;"><br></span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;">Thanks for help. </span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style: normal;"><span style="font-family: 'times new roman', 'new york', times, serif; background-color: transparent;"><br></span></div><div style="background-color: transparent; color: rgb(0, 0, 0); font-size: 16px; font-family: 'times new roman', 'new york', times, serif; font-style:
normal;">Hs</div></div></div></body></html>