Regular expression

Beema shafreen beema.shafreen at gmail.com
Wed Jul 16 16:09:42 CEST 2008


Hi all,

How do I write a regular expression for this kind of sequences

>gi|158028609|gb|ABW08583.1| CG8385-PF, isoform F [Drosophila melanogaster]
MGNVFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVE

thanks

-- 
Beema Shafreen
-------------- next part --------------
An HTML attachment was scrubbed...
URL: <http://mail.python.org/pipermail/python-list/attachments/20080716/88b7a148/attachment.html>


More information about the Python-list mailing list